SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1dt4A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dt4A
Domain Number 1 Region: 5-60
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.26e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1dt4A   PDB: 1dt4   SUPERFAMILY: 1dt4A
Sequence length 73
Comment (A:)
Sequence
mkdvveiavpenlvgailgkggktlveyqeltgcriqiskkgeflpgtrnrkvtitgtpa
atqaaqylitqri
Download sequence
Identical sequences 000070771|e1dt4A1|327.11.2.14|A:1-73 cath|current|1dt4A00/4-76 d1dt4a_ 1dt4_A 1dt4A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]