SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1f5bA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1f5bA
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.98e-25
Family 7-Fe ferredoxin 0.00000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1f5bA   PDB: 1f5b   SUPERFAMILY: 1f5bA
Sequence length 106
Comment (A:)
Sequence
ahvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Download sequence
Identical sequences 1f5bA 1f5b_A 000066987|e1f5bA1|205.1.1.3|A:1-106 cath|current|1f5bA00/1-106 d1f5ba_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]