SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1j8fA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j8fA
Domain Number 1 Region: 31-307
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 8.76e-119
Family Sir2 family of transcriptional regulators 0.0000000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j8fA   PDB: 1j8f   SUPERFAMILY: 1j8fA
Sequence length 323
Comment (A:)
Sequence
geadmdflrnlfsqtlslgsqkerlldeltlegvarymqsercrrviclvgagistsagi
pdfrspstglydnlekyhlpypeaifeisyfkkhpepffalakelypgqfkptichyfmr
llkdkglllrcytqnidtleriagleqedlveahgtfytshcvsascrheyplswmkeki
fsevtpkcedcqslvkpdivffgeslparffscmqsdflkvdlllvmgtslqvqpfasli
skaplstprllinkekagqsdpflgmimglgggmdfdskkayrdvawlgecdqgclalae
llgwkkeledlvrrehasidaqs
Download sequence
Identical sequences 1j8fA d1j8fa_ d1j8fb_ 1j8f_A 1j8f_B 1j8f_C 5g4c_A 5g4c_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]