SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jscA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jscA
Domain Number 1 Region: 414-590
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.67e-104
Family Pyruvate oxidase and decarboxylase PP module 0.00000000371
Further Details:      
 
Domain Number 2 Region: 36-199
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.51e-99
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000000596
Further Details:      
 
Domain Number 3 Region: 231-378
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 9.69e-69
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jscA   PDB: 1jsc
Sequence length 630
Comment (A:)
Sequence
apsfnvdpleqpaepsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypgga
ilpvydaihnsdkfnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmada
fadgipmvvftgqvptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeia
tsgrpgpvlvdlpkdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlin
lakkpvlyvgagilnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgc
atanlavqnadliiavgarfddrvtgniskfapearraaaegrggiihfevspkninkvv
qtqiavegdattnlgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvi
kklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqv
akpeslvididgdasfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehrysh
thqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvag
gsgldefinfdpeverqqtelrhkrtggkh
Download sequence
Identical sequences 1jscA 1jsc_A 1jsc_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]