SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jx9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jx9A
Domain Number 1 Region: 5-204
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.55e-61
Family Penicillin acylase, catalytic domain 0.00000000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jx9A   PDB: 1jx9
Sequence length 209
Comment (A:)
Sequence
aeqssseikivrdeygmphiyandtwhlfygygyvvaqdrlfqmemarrstqgtvaevlg
kdfvkfdkdirrnywpdairaqiaalspedmsilqgyadgmnawidkvntnpetllpkqf
ntfgftpkrwepfdvamifvgtmanrfsdstseidnlalltalkdkygvsqgmavfnqlk
wlvnpsapttiavqesnyplkfnqqnsqt
Download sequence
Identical sequences 1jx9A 1jx9_A 1k5q_A 1k5s_A 1k7d_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]