SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1kgmA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kgmA
Domain Number 1 Region: 1-34
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00000000000146
Family PMP inhibitors 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1kgmA   PDB: 1kgm   SUPERFAMILY: 1kgmA
Sequence length 35
Comment (A:)
Sequence
evtcepgttfkdkcntcrcgsdgksaactlkacpq
Download sequence
Identical sequences d1kgma_ 1kgmA 1kgm_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]