SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1kvjA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kvjA
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 1.76e-32
Family HMA, heavy metal-associated domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1kvjA   PDB: 1kvj   SUPERFAMILY: 1kvjA
Sequence length 79
Comment (A:)
Sequence
mdpsmgvnsvtisvegmtcnscvwtieqqigkvngvhhikvsleeknatiiydpklqtpk
tlqeaiddmgfdavihnpd
Download sequence
Identical sequences cath|current|1kviA00/1-79 cath|current|1kvjA00/1-79 d1kvia_ d1kvja_ 1kvi_A 1kvj_A 1kvjA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]