SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ldkD from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ldkD
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily POZ domain 5.15e-39
Family BTB/POZ domain 0.046
Further Details:      
 
Domain Number 2 Region: 96-133
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.54e-30
Family Skp1 dimerisation domain-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ldkD   PDB: 1ldk
Sequence length 133
Comment (D:)
Sequence
psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
dppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmi
kgktpeeirktfn
Download sequence
Identical sequences 1ldk_D 1ldkD 001180282|e1fs1B1|226.1.1.5|B:2-134 001772466|e1fs1D1|226.1.1.5|D:2-134 001772688|e1ldkD1|226.1.1.5|D:1-133 cath|current|1ldkD00/2002-2140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]