SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1m2hA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1m2hA
Domain Number 1 Region: 3-239
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 6e-128
Family Sir2 family of transcriptional regulators 0.00000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1m2hA   PDB: 1m2h   SUPERFAMILY: 1m2hA
Sequence length 249
Comment (A:)
Sequence
mdekllktiaeskylvaltgagvaaesgiptfrgkdglwnryrpeelanpqafakdpekv
wkwyawrmekvfnaqpnkahqafaelerlgvlkclitqnvddlheragsrnvihlhgslr
vvrctscnnsfevesapkipplpkcdkcgsllrpgvvwfgemlppdvldramreveradv
iivagtsavvqpaaslplivkqrggaiieinpdetpltpiadyslrgkagevmdelvrhv
rkalslkln
Download sequence
Identical sequences 1m2hA 1m2h_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]