SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1n00A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1n00A
Domain Number 1 Region: 12-318
Classification Level Classification E-value
Superfamily Annexin 1.54e-152
Family Annexin 0.00000000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1n00A   PDB: 1n00   SUPERFAMILY: 1n00A
Sequence length 321
Comment (A:)
Sequence
mahhhhatltvpttvpsvsedceqlrkafsgwgtnegliidilghrnaeqrnlirktyae
tygedllkaldkelsndferlvllwaldpaerdallaneatkrwtssnqvlmeiactrsa
nqllharqayharykksleedvahhttgdfhklllplvssyryegeevnmtlakteakll
hekisnkaysdddvirvlatrskaqinatlnhykneygndinkdlkadpkdeflallrst
vkclvypekyfekvlrlainrrgtdegaltrvvctraevdlkviadeyqrrnsvpltrai
vkdthgdyeklllvlaghven
Download sequence
Identical sequences 1n00_A 1n00A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]