SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1olxB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1olxB
Domain Number 1 Region: 5-202
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.76e-65
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000000378
Further Details:      
 
Domain Number 2 Region: 206-342
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.98e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.000000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1olxB   PDB: 1olx
Sequence length 342
Comment (B:)
Sequence
vahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvgl
rdkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryr
sgdlfncgsltirspwgcvghgalyasqspeaffahcpgikvviprspfqakglllscie
dknpciffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasm
akeklgvscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecf
lnleapisrvcgydtpfphifepfyipdkwkcydalrkminy
Download sequence
Identical sequences 1olx_B 1olxB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]