SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qrcA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qrcA
Domain Number 1 Region: 6-559
Classification Level Classification E-value
Superfamily Pectin lyase-like 0
Family P22 tailspike protein 0.000000000000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qrcA   PDB: 1qrc   SUPERFAMILY: 1qrcA
Sequence length 559
Comment (A:)
Sequence
ydpdqysieadkkfkysvklsdyptlqdaasaavdgllidrdynfyggetvdfggkvlti
eckakfigdgnliftklgkgsriagvfmestttpwvikpwtddnqwltdaaavvatlkqs
ktdgyqptvsdyvkfpgietllppnakgqnitstleirecigvevhrasglmagflfrgc
hfckmvdannpsggkdgiitfenlsgdwgkgnyviggrtsygsvssaqflrnnggferdg
gvigftsyragesgvktwqgtvgsttsrnynlqfrdsvviypvadgfdlgadtdmnpeld
rpgdypitqyplhqlplnhlidnllvrgalgvgfgmdgkgmyvsnitvedcagsgayllt
hesvftniaiidtntkdfqanqiyisgacrvnglrligirstdgqsltidapnstvsgit
gmvdpsrinvanlaeeglgniransfgydsaaiklrihklsktldsgalyshinggagsg
saytqltaisgstpdavslkvnhkdcrgaeipfvpdiasddfikdsscflpywennstsl
kalvkkpngelvrltlatl
Download sequence
Identical sequences cath|current|1qrcA00/113-666 1qrcA 1qrc_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]