SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qs0B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qs0B
Domain Number 1 Region: 3-221
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.35e-69
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000000123
Further Details:      
 
Domain Number 2 Region: 206-336
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.03e-43
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.000000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1qs0B   PDB: 1qs0
Sequence length 338
Comment (B:)
Sequence
atttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapis
esgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmpc
gggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyng
pfdghhdrpvtpwskhphsavpdgyytvpldkaaitrpgndvsvltygttvyvaqvaaee
sgvdaevidlrslwpldldtivesvkktgrcvvvheatrtcgfgaelvslvqehcfhhle
apiervtgwdtpyphaqewayfpgpsrvgaalkkvmev
Download sequence
Identical sequences 1qs0B 1qs0_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]