SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1s5pA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1s5pA
Domain Number 1 Region: 2-230
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.86e-112
Family Sir2 family of transcriptional regulators 0.00000000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1s5pA   PDB: 1s5p   SUPERFAMILY: 1s5pA
Sequence length 235
Comment (A:)
Sequence
kprvlvltgagisaesgirtfraadglweehrvedvatpegfdrdpelvqafynarrrql
qqpeiqpnaahlalaklqdalgdrfllvtqnidnlheragntnvihmhgellkvrcsqsg
qvldwtgdvtpedkchccqfpaplrphvvwfgemplgmdeiymalsmadifiaigtsghv
ypaagfvheaklhgahtvelnlepsqvgnefaekyygpasqvvpefvekllkglk
Download sequence
Identical sequences 1s5p_A d1s5pa_ 1s5pA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]