SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1tbpA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tbpA
Domain Number 1 Region: 91-175
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 4.39e-54
Family TATA-box binding protein (TBP), C-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 6-85
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.61e-52
Family TATA-box binding protein (TBP), C-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tbpA   PDB: 1tbp
Sequence length 180
Comment (A:)
Sequence
mgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
Download sequence
Identical sequences 1tbpA 1tbp_A 1tbp_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]