SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1tywA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1tywA
Domain Number 1 Region: 1-554
Classification Level Classification E-value
Superfamily Pectin lyase-like 0
Family P22 tailspike protein 0.000000000000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1tywA   PDB: 1tyw   SUPERFAMILY: 1tywA
Sequence length 554
Comment (A:)
Sequence
ysieadkkfkysvklsdyptlqdaasaavdgllidrdynfyggetvdfggkvltieckak
figdgnliftklgkgsriagvfmestttpwvikpwtddnqwltdaaavvatlkqsktdgy
qptvsdyvkfpgietllppnakgqnitstleirecigvevhrasglmagflfrgchfckm
vdannpsggkdgiitfenlsgdwgkgnyviggrtsygsvssaqflrnnggferdggvigf
tsyragesgvktwqgtvgsttsrnynlqfrdsvviypvwdgfdlgadtdmnpeldrpgdy
pitqyplhqlplnhlidnllvrgalgvgfgmdgkgmyvsnitvedcagsgayllthesvf
tniaiidtntkdfqanqiyisgacrvnglrligirstdgqgltidapnstvsgitgmvdp
srinvanlaeeglgniransfgydsaaiklrihklsktldsgalyshinggagsgsaytq
ltaisgstpdavslkvnhkdcrgaeipfvpdiasddfikdsscflpywennstslkalvk
kpngelvrltlatl
Download sequence
Identical sequences 1tywA 1tyu_A 1tyv_A 1tyw_A 1tyx_A cath|current|1tyuA00/113-666 cath|current|1tyvA00/113-666 cath|current|1tywA00/113-666 cath|current|1tyxA00/113-666 d1tyua_ d1tyva_ d1tywa_ d1tyxa_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]