SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1umdB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1umdB
Domain Number 1 Region: 4-193
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.72e-75
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000000122
Further Details:      
 
Domain Number 2 Region: 188-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.32e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1umdB   PDB: 1umd
Sequence length 324
Comment (B:)
Sequence
malmtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplse
aaivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsg
ggvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsv
keevpeedytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlm
pwdyeavmnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpyp
yaqdklylptvtrilnaakraldy
Download sequence
Identical sequences 1umdB 1um9_B 1um9_D 1umb_B 1umb_D 1umc_B 1umc_D 1umd_B 1umd_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]