SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1v16A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1v16A
Domain Number 1 Region: 28-395
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.46e-116
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000000000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1v16A   PDB: 1v16   SUPERFAMILY: 1v16A
Sequence length 400
Comment (A:)
Sequence
sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighastsddssaf
rsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
Download sequence
Identical sequences cath|current|1v16A00/6-400 1v16A 1v16_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]