SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1vqzA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1vqzA
Domain Number 1 Region: 16-253
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.39e-94
Family LplA-like 0.000000241
Further Details:      
 
Domain Number 2 Region: 255-338
Classification Level Classification E-value
Superfamily SufE/NifU 2.47e-33
Family SP1160 C-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1vqzA   PDB: 1vqz
Sequence length 341
Comment (A:)
Sequence
mgsdkihhhhhhmkyiinhsndtafnialeeyafkhlldedqifllwinkpsiivgrhqn
tieeinrdyvrengievvrrisgggavyhdlnnlnytiiskedenkafdfksfstpvint
laqlgvkaeftgrndleidgkkfcgnaqayingrimhhgcllfdvdlsvlanalkvskdk
feskgvksvrarvtniinelpkkitvekfrdllleymkkeypemteyvfseeelaeinri
kdtkfgtwdwnygkspefnvrrgikftsgkvevfanvteskiqdikiygdffgiedvaav
edvlrgvkyeredvlkalktiditryfagisreeiaeavvg
Download sequence
Identical sequences 1vqz_A 1vqzA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]