SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1w85B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1w85B
Domain Number 1 Region: 2-192
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.32e-68
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000000826
Further Details:      
 
Domain Number 2 Region: 187-324
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.42e-43
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.000000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1w85B   PDB: 1w85
Sequence length 324
Comment (B:)
Sequence
aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
qevpegeytipigkadikregkditiiaygamvheslkaaaelekegisaevvdlrtvqp
ldietiigsvektgraivvqeaqrqagiaanvvaeinerailsleapvlrvaapdtvypf
aqaesvwlpnfkdvietakkvmnf
Download sequence
Identical sequences 1w85B 1w85_B 1w85_D 1w85_F 1w85_H 1w88_B 1w88_D 1w88_F 1w88_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]