SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1weiA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1weiA
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily DNA-glycosylase 6.46e-79
Family Mismatch glycosylase 0.00000000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1weiA   PDB: 1wei   SUPERFAMILY: 1weiA
Sequence length 225
Comment (A:)
Sequence
mqasqfsaqvldwydkygratlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvkrvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk
Download sequence
Identical sequences d1wefa_ 1weiA 1wef_A 1wei_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]