SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1wouA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wouA
Domain Number 1 Region: 3-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.83e-29
Family Txnl5-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wouA   PDB: 1wou   SUPERFAMILY: 1wouA
Sequence length 123
Comment (A:)
Sequence
MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHI
SEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLF
SED
Download sequence
Identical sequences A0A140VJY7 A0A2I3H5Q4 G3QKM5 H2QC11 Q9BRA2
gi|14249348|ref|NP_116120.1| ENSNLEP00000011250 ENSGGOP00000003003 ENSPTRP00000014752 1wouA 9598.ENSPTRP00000014752 9606.ENSP00000250101 ENSP00000250101 ENSP00000250101 ENSP00000250101 cath|current|1wouA00/4-122 ENSGGOP00000003003 ENSNLEP00000011250 1wou_A ENSPTRP00000014752 NP_116120.1.87134 NP_116120.1.92137 XP_003274631.1.23891 XP_003810187.1.60992 XP_004058471.1.27298 XP_511988.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]