SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wriA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wriA
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.98e-37
Family 2Fe-2S ferredoxin-related 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wriA   PDB: 1wri   SUPERFAMILY: 1wriA
Sequence length 93
Comment (A:)
Sequence
AYKVTLKTPDGDITFDVEPGERLIDIGSEKADLPLSCQAGACSTCLGKIVSGTVDQSEGS
FLDDEQIEQGYVLTCIAIPESDVVIETHKEDEL
Download sequence
Identical sequences P00237
1wri_A 1wriA 000006105|e1wriA1|221.1.1.12|A:1-93 cath|current|1wriA00/1-93 d1wria_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]