SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1yqrA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1yqrA
Domain Number 1 Region: 128-314
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.56e-46
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000132
Further Details:      
 
Domain Number 2 Region: 4-127
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.05e-38
Family DNA repair glycosylase, N-terminal domain 0.000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1yqrA   PDB: 1yqr
Sequence length 319
Comment (A:)
Sequence
sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
gvrllrqdpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqala
gpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgt
qvadciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwg
pyagwaqavlfsadlrqsr
Download sequence
Identical sequences 1yql_A 1yqm_A 1yqr_A 1yqrA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]