SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1zk8A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1zk8A
Domain Number 1 Region: 80-181
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 9.84e-26
Family Tetracyclin repressor-like, C-terminal domain 0.00000181
Further Details:      
 
Domain Number 2 Region: 7-75
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000227
Family Tetracyclin repressor-like, N-terminal domain 0.0000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1zk8A   PDB: 1zk8
Sequence length 183
Comment (A:)
Sequence
MMSPRIGLTLQKIVETAAEIADANGVQEVTLASLAQTLGVRSPSLYNHVKGLQDVRKNLG
IYGIKKLHNRLEEAAEDKRMDEAIHALGEAYVAFVRKHPGLYEATFLRDEEVRKAGDGIV
KLCLQVLQQYGLEGENALHATRGFRSICHGFASIEQQGGFGLPLDLDISLHVLLETFIKG
LRE
Download sequence
Identical sequences Q815X4
APC26195 gi|30023040|ref|NP_834671.1| 1zk8A NP_834671.1.86172 1zk8_A 1zk8_B 226900.BC5000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]