SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2adzA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2adzA
Domain Number 1 Region: 77-177
Classification Level Classification E-value
Superfamily PH domain-like 3.86e-33
Family Pleckstrin-homology domain (PH domain) 0.0000741
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2adzA   PDB: 2adz
Sequence length 178
Comment (A:)
Sequence
asgrraprtgllelrcgagsgaggerwqrvllslaedaltvspadgepgpepepaqlnga
aepgaappqlpealllqrevspyfknsaggtsvgwdsppasplqrqpsspgpqprnlsea
khvslkmayvsrrctptdpepryleicaadgqdavflrakdeasarswagaiqaqigt
Download sequence
Identical sequences 2adz_A 2adzA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]