SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2bfdB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bfdB
Domain Number 1 Region: 5-202
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.21e-66
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000000034
Further Details:      
 
Domain Number 2 Region: 206-342
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.98e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.000000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2bfdB   PDB: 2bfd
Sequence length 342
Comment (B:)
Sequence
vahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvgl
rdkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryr
sgdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscie
dknpciffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasm
akeklgvscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecf
lnleapisrvcgydtpfphifepfyipdkwkcydalrkminy
Download sequence
Identical sequences 1dtw_B 1ols_B 1olu_B 1u5b_B 1v11_B 1v16_B 1v1m_B 1v1r_B 1wci_B 1x7w_B 1x7x_B 1x7y_B 1x7z_B 1x80_B 2beu_B 2bev_B 2bew_B 2bfb_B 2bfc_B 2bfd_B 2bfe_B 2bff_B 2bfdB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]