SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2gzlA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2gzlA
Domain Number 1 Region: 3-158
Classification Level Classification E-value
Superfamily IpsF-like 4.61e-116
Family IpsF-like 0.0000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2gzlA   PDB: 2gzl
Sequence length 159
Comment (A:)
Sequence
lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
dlgchmddvnvkattteklgftgrgegiaceavallika
Download sequence
Identical sequences 2gzlA 2gzl_A cath|current|2gzlA00/-1-157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]