SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2i94A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2i94A
Domain Number 1 Region: 9-175
Classification Level Classification E-value
Superfamily EF-hand 1.94e-56
Family Calmodulin-like 0.0000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2i94A   PDB: 2i94
Sequence length 202
Comment (A:)
Sequence
MGNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEA
DPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKN
EVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANK
EILRLIQFEPQKVKEKLKEKKL
Download sequence
Identical sequences P21457
NP_776590.1.59421 NP_776590.1.76553 2i94_A ENSBTAP00000034949 ENSBTAP00000034949 2i94A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]