SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ihoA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ihoA
Domain Number 1 Region: 156-293
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.74e-68
Family MOA C-terminal domain-like 0.00000472
Further Details:      
 
Domain Number 2 Region: 5-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.95e-35
Family Ricin B-like 0.000000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ihoA   PDB: 2iho
Sequence length 293
Comment (A:)
Sequence
MSLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTF
TLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKT
FVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGY
ILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFA
IFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Download sequence
Identical sequences Q8X123
2iho_A 3ef2_A 3ef2_B 3ef2_C 3ef2_D 5d61_A 5d62_A 5d63_A 2ihoA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]