SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ozlB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ozlB
Domain Number 1 Region: 15-197
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.19e-67
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000000931
Further Details:      
 
Domain Number 2 Region: 205-340
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.34e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.000000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ozlB   PDB: 2ozl
Sequence length 341
Comment (B:)
Sequence
mrgshhhhhhgslqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkyg
dkriidtpisemgfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglq
pvpivfrgpngasagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvv
vlenelmygvpfefppeaqskdflipigkakierqgthitvvshsrpvghcleaaavlsk
egvecevinmrtirpmdmetieasvmktnhlvtveggwpqfgvgaeicarimegpafnfl
dapavrvtgadvpmpyakilednsipqvkdiifaikktlni
Download sequence
Identical sequences 1ni4_B 1ni4_D 2ozl_B 2ozl_D 6cfo_B 6cfo_D 2ozlB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]