SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2p0lA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2p0lA
Domain Number 1 Region: 13-261
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.19e-61
Family LplA-like 0.000000000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2p0lA   PDB: 2p0l
Sequence length 288
Comment (A:)
Sequence
mslewqdlaqlpvsifkdyvtdaqdaekpfiwtevflreinrsnqeiilhiwpmtktvil
gmldrelphlelakkeiisrgyepvvrnfgglavvadegilnfslvipdvferklsisdg
ylimvdfirsifsdfyqpiehfevetsycpgkfdlsingkkfaglaqrrikngiavsiyl
svcgdqkgrsqmisdfykiglgdtgspiaypnvdpeimanlsdlldcpmtvedvidrmli
slkqvgfndrllmirpdlvaefdrfqaksmankgmvsrdeeghhhhhh
Download sequence
Identical sequences 2p0lA 2p0l_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]