SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2qtaA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2qtaA
Domain Number 1 Region: 57-468
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.06e-145
Family TK-like PP module 0.000000000000292
Further Details:      
 
Domain Number 2 Region: 473-700
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.18e-99
Family TK-like Pyr module 0.000000000764
Further Details:      
 
Domain Number 3 Region: 701-884
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.07e-64
Family Transketolase C-terminal domain-like 0.0000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2qtaA   PDB: 2qta
Sequence length 886
Comment (A:)
Sequence
serfpndvdpietrdwlqaiesvireegveraqylidqllaearkggvnvaagtgisnyi
ntipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssatiydvc
fnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgnglssyphp
klmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemdepeskg
aitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwgsrwde
llrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeqiwaln
rgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaakgkniahqvkkmnmdgvrhi
rdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnfteklelpslqd
fgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeglfrqigiysp
ngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnlpmipfyiyys
mfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydp
ayayevavimhdglermygekqenvyyyittlnenyhmpampegaeegirkgiykletie
gskgkvqllgsgsilrhvreaaeilakdygvgsdvysvtsftelardgqdcerwnmlhpl
etprvpyiaqvmndapavastdymklfaeqvrtyvpaddyrvlgtdgfgrsdsrenlrhh
fevdasyvvvaalgelakrgeidkkvvadaiakfnidadkvnprla
Download sequence
Identical sequences 2qta_A 2qta_B 2qtc_A 2qtc_B 2qtaA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]