SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2r8oA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2r8oA
Domain Number 1 Region: 5-328
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.89e-246
Family TK-like PP module 0.00000282
Further Details:      
 
Domain Number 2 Region: 334-523
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.11e-117
Family TK-like Pyr module 0.0000165
Further Details:      
 
Domain Number 3 Region: 536-663
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.98e-75
Family Transketolase C-terminal domain-like 0.0000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2r8oA   PDB: 2r8o
Sequence length 669
Comment (A:)
Sequence
mssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrf
vlsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgi
anavgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgklia
fyddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsl
lmcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeag
qakesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrka
sqnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiang
islhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqva
slrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniargg
yvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresv
lpkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakak
ellhhhhhh
Download sequence
Identical sequences 2r8oA 2r5n_A 2r5n_B 2r8o_A 2r8o_B 2r8p_A 2r8p_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]