SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3cluD from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3cluD
Domain Number 1 Region: 198-318
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.44e-39
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.00000063
Further Details:      
 
Domain Number 2 Region: 3-190
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.49e-38
Family ETFP subunits 0.0000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3cluD   PDB: 3clu
Sequence length 321
Comment (D:)
Sequence
mskilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvde
lvvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvy
iveyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsv
qsrsqnkdyvevgggndidittvdfimsigrgigeetnveqfreladeagatlccskpia
dagwlpksrqvgqsgkvvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftia
kygivadifdieeelkaqlaa
Download sequence
Identical sequences 3clu_D 3cluD

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]