SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297623777|ref|YP_003705211.1| from Truepera radiovictrix DSM 17093

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297623777|ref|YP_003705211.1|
Domain Number 1 Region: 152-201
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000265
Family Type I dockerin domain 0.0052
Further Details:      
 
Domain Number 2 Region: 38-147
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000286
Family Matrix metalloproteases, catalytic domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297623777|ref|YP_003705211.1|
Sequence length 273
Comment hypothetical protein [Truepera radiovictrix DSM 17093]
Sequence
MRRLWGALAASTLIVGGAAFAVDYRLNAEGGPGDLGERVARAFERWAAVEGGEVRFNEDP
AAPAVIRYGDGTRFGPDTLSLTVQRTPETETRVLLNPTAPDERALLHEVGLLLGLAPAPL
TQSVMNPLLGPGAGAELTPADEAALRARVAFAPEDINQDGVVDFYDLAALAAAYGSRGVN
LPEDITGDGVVDGADLERLRAAYVFGAPAEVPPEAAVEGDPEAMTGGAMTGGAMTGGALT
GEEGRADVAGGGEADADAPDDLDGADDAAEGGL
Download sequence
Identical sequences D7CXR6
gi|297623777|ref|YP_003705211.1| WP_013178036.1.68051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]