SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070005 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070005
Domain Number 1 Region: 372-395
Classification Level Classification E-value
Superfamily DPY module 0.0000301
Family DPY module 0.0022
Further Details:      
 
Weak hits

Sequence:  FBpp0070005
Domain Number - Region: 329-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00469
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 104-127
Classification Level Classification E-value
Superfamily DPY module 0.00994
Family DPY module 0.0046
Further Details:      
 
Domain Number - Region: 65-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0285
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070005   Gene: FBgn0031089   Transcript: FBtr0070006
Sequence length 441
Comment pep:known chromosome:BDGP5:X:20042157:20049547:1 gene:FBgn0031089 transcript:FBtr0070006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQLLVVALVAVAIASLPQLAAGKKLGKRCVNCTYRTYYTYGDGRSLQRVVYRDPVYTRA
QSYASGCSGSPCGVNAVCQEASGGRPVCSCPPGFSGNPLTHCNRGECLDNVDCRDNLQCK
DNRCVNPCVGACGIGSNCDARNHVAVCSCPAGYNGDPYHACHLNDPEEQCHPSPCGVNTK
CEIINGVPTCSCVHGYVGNPLSGCRHECDHDGDCSSRDMCSSNFKCVPACGQCGTGATCR
TVSNHRAVCECPKGYIGSPYTECRPECYGDADCPAGRPACFYGICKNTCEGACGIGADCN
LRGLTPVCSCPRDMTGDPFVRCRPFTKEDLCDPNPCGTNAICVPGHDNTGRERPVCNCLP
GHTGNPLSHCTRGECLSNNECPDHRACINYQCIDPCIGKCATGASCEPKAHLAVCRCPQG
QSGDALVSCRQTRTFPVAKYH
Download sequence
Identical sequences Q9W5X1
FBpp0070005 FBpp0070005 7227.FBpp0070005 NP_608372.1.81976 FBpp0070005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]