SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070045 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070045
Domain Number 1 Region: 720-778
Classification Level Classification E-value
Superfamily RING/U-box 0.00000871
Family RING finger domain, C3HC4 0.039
Further Details:      
 
Weak hits

Sequence:  FBpp0070045
Domain Number - Region: 23-187
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0135
Family WD40-repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070045   Gene: FBgn0052350   Transcript: FBtr0070046
Sequence length 830
Comment pep:known chromosome:BDGP5:3L:23140756:23143599:-1 gene:FBgn0052350 transcript:FBtr0070046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDISVFEWKKVDLFNIIVVPFVKIPNTAEISCYCFPESKSSTEERNIKLVICDKNRNILI
YLSNWECITFKSPSTRKAIALCSLTSNNSLATVTPDINNGIHIDIFDLNRLTKKQAAPII
ASAYTQPSSTPLCLNADVIDDKLFALAIGLGNGDILLHYGKITKNFSANIRQHTVSGNAV
NGIHFDFKTQPLDTTQIMFVTCVQGVYCFMLKEKCIMDTKFVLDNDKGNLNYRSIMCKAG
GGEINDSMLVVGRADAVYCYTPEGRGPCFAIEGAKECLAWVGHYLIVGVKNSNLKQNATT
LIVLDTENKIIVFQRQFQELFYVISENNFCYIVTNSGDTDACNMLMLEKNSIDVNIRLLV
EKHMYNIALRLLHREGYTSSPETALVRFQYGNHLLQKGDFSRATQEFIKTIGFIKPYAVI
SKLLYSRYNTYLLNYLTEWKKKNESSSCHTRLIECCIKRDQIEHEMQQDDFKHYKSPAKI
KHLATLSKMYFACTPSNQVPVEEEHLLHQLLEYGPASLAVDLTTYLNNITFENVKESKNI
LSFCSILADHNDYCAKMLAKIIEAFPVCDEKLLFYLLVFYFKLWRLDKVTSSFVSDFIKT
HSLRMDKTIIVSRLYTFFNVTQRIHGHQKNTGTLHNETIDKCIENLIKNNPDVALNENLS
KRSFLMMLKSSCSTEEIKAIKIKPIFKDRLLRSIVDSANELKLVENFNEKIKRSRSMLSL
YTNNPIEFRNDKCDICREMLSMQSIYFLCQHSFHEECLNYKSTKRQEKFLCIICKTRNLL
SPKHSSNFSCDSSDTIAVLAKIVSIGNKLETKLMIRGRQKSDGVTCNPFN
Download sequence
Identical sequences Q8SX81
FBpp0070045 FBpp0070045 FBpp0070045 7227.FBpp0070045 NP_730776.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]