SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070115 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070115
Domain Number 1 Region: 357-406
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000000188
Family CCCH zinc finger 0.0015
Further Details:      
 
Domain Number 2 Region: 330-355
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000785
Family CCCH zinc finger 0.002
Further Details:      
 
Weak hits

Sequence:  FBpp0070115
Domain Number - Region: 448-494,554-568
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000256
Family beta-sandwich domain of Sec23/24 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070115   Gene: FBgn0003575   Transcript: FBtr0070120
Sequence length 1325
Comment pep:known chromosome:BDGP5:X:529920:537793:1 gene:FBgn0003575 transcript:FBtr0070120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVALADEPLIDLEEDLEDGEIDDDEEDEQQSSKIQVQKKTFVGDDDVQFVGVEAKNQND
DEDVVYVGPSTDAVCLQNSNSTKSKKPRPLEDDHASSIELAIANALKKKGIEPPMPRMRS
SNQDTSDQSLEGSGEGLATANPLLQSTRSSRRRKRKKEREREQKKDKEQQNRSRRDENDV
SVVPGGVEDMDEYEMMNVRGGSPPPGGAAPPLSSCGQRFSGADWDMDDGSAATGAAGLGA
GGGGGYNSHSSYDSYSDEETNGPGLMNQRRRTRRDNEKEHQRGVNNRKRRDRDRLEGGLA
GSGSKRNRRDSGEGGGGGQEKMGGSNRVEPRKLELCKFYLMDCCAKRDKCSYMHKEFPCK
YYYLGMDCYAGDDCLFYHGEPLSEQLRNVLLKHMETAPKEILGDFKRISRDIAIVQMTRR
HEQLCDQLNRENTWNSIGCGLMGKRQDHQMQQQQQQLQHQQLQQQQEQQQTQQQAAADGG
GCIPSLLDMVINPPLSENKRKSRWTEKMGAKAAAGAAGSSERDSTSPDAKPLPPHLDLAN
LSHVLSAENMAKLNKLGITNLEQMLQVPFGQLTEAGLTLVEIGEIQRKAEDAKPQTQAEL
ESSTPPSKRETEANNSNSKSNGLIMVDYTQYLKDAHVSFSGNDPLDDDRDDDEQLIIDDG
NDSTAEEDQQPKKAKAPPAATHESSTEEAPLPSVFDLPSFMNNMLGQGSSARQLLPASAT
SPNQENAHLPGGDQSTHKSAPIGGGTSTNVLGRILFGDKQSDPEARAAFYRDIIRNPFKA
HSGDGDVDSSNENSNSNSHSLTPTPTPEPGSQSPKPEDHDQDMPELPVIAPALPPTTPSL
YVRRSMYDFDPVKEQEHGRQELLTEEKEQYQRDTDMRLPFEPMKHYMPATEIDAAIFSHT
PIRWQLHEVTIEESSYAQIRASALHKEQRELRDPRMRRILGLPETPDNSGPLGSVPIMGP
SSFSVDNIARCATTIASPDLETAVRDSTPSSPPPSVVNLPSMSVPPPSMRVPPPNIQVEK
PTVRTDPRRDPRRAVLQAPTKGASTANTTAPNASGGSKQISEIRSLLQVSNWYNNLGTNN
KIMVNQQLALVFTELKKFHQLPNDAPKIFDVSFIVNNTTLQQIFAKLFIFVDDNGEVVQI
PEEPNGNGAALGGGGDSGGGVGGGGGGGGVVLPNLSQPPPNLSQMLRLPPPNIRMLRMSG
MMMQMGNVGPPFNQPPPRGGLMGMPPNGNGLNQGVGNLGGLGQLGINQGGGPVPNGNPFN
PFGGNNGGGAGVMNNMNSMGNMGMGFNNFNNNGGRGGHFPGGGSGGNGNGNNRNQRGGNH
RNRNI
Download sequence
Identical sequences M9W963 P22293
7227.FBpp0070115 FBpp0070115 NP_001284753.1.81976 NP_476754.1.81976 FBpp0070115 FBpp0070115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]