SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070117 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070117
Domain Number 1 Region: 20-105
Classification Level Classification E-value
Superfamily RING/U-box 9.89e-40
Family RING finger domain, C3HC4 0.00000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070117   Gene: FBgn0025638   Transcript: FBtr0070122
Sequence length 108
Comment pep:known chromosome:BDGP5:X:541320:542181:1 gene:FBgn0025638 transcript:FBtr0070122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGH
Download sequence
Identical sequences B4I946 B4R7G5 Q9W5E1 X2JA05
NP_001284754.1.81976 NP_569852.1.81976 XP_002040256.1.34323 XP_002105838.1.80810 FBpp0200559 7290070___KOG2930 FBpp0214922 FBpp0070117 FBpp0070117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]