SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070127 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070127
Domain Number 1 Region: 1682-1871
Classification Level Classification E-value
Superfamily Fibronectin type III 5.03e-37
Family Fibronectin type III 0.00089
Further Details:      
 
Domain Number 2 Region: 640-857
Classification Level Classification E-value
Superfamily Fibronectin type III 8.6e-36
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 3 Region: 856-1055
Classification Level Classification E-value
Superfamily Fibronectin type III 2.48e-35
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 4 Region: 1275-1466
Classification Level Classification E-value
Superfamily Fibronectin type III 9.43e-34
Family Fibronectin type III 0.0000787
Further Details:      
 
Domain Number 5 Region: 1067-1272
Classification Level Classification E-value
Superfamily Fibronectin type III 5.43e-33
Family Fibronectin type III 0.00025
Further Details:      
 
Domain Number 6 Region: 1471-1679
Classification Level Classification E-value
Superfamily Fibronectin type III 9.33e-32
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 7 Region: 454-544
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-19
Family I set domains 0.0063
Further Details:      
 
Domain Number 8 Region: 547-645
Classification Level Classification E-value
Superfamily Immunoglobulin 4.99e-19
Family I set domains 0.046
Further Details:      
 
Domain Number 9 Region: 350-451
Classification Level Classification E-value
Superfamily Immunoglobulin 4.07e-18
Family I set domains 0.0077
Further Details:      
 
Domain Number 10 Region: 68-138,183-247
Classification Level Classification E-value
Superfamily Immunoglobulin 2.03e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 11 Region: 1869-1975
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000186
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 12 Region: 259-363
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000388
Family I set domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070127   Gene: FBgn0021764   Transcript: FBtr0070132
Sequence length 2224
Comment pep:known chromosome:BDGP5:X:580873:643529:1 gene:FBgn0021764 transcript:FBtr0070132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKSAASSLRRRRPKTTITATLAIEMPSQPKLASLLAVLVLLCYCDSCFFCYADANLQQQ
NSIVQQQQLQAPRFTTHPSSSGSIVSEGSTKILQCHALGYPQPTYRWLKDGVPVGDFSSS
QFYRFHSTRREDAGSYQCIARNDAGSIFSEKSDVVVAYMGIFENTTEGRLTVISGHPAIF
DMPPIESIPVPSVMWQSEDGPLNYDIKYAFTHANQLIILSADENDRKGYRAKAINTQLGK
EESSAFVHLNVSGDPYIEVAPEIIVRPQDVKVKVGTGVVELQCIANARPLHELETLWLKD
GLAVETAGVRHTLNDPWNRTLALLQANSSHSGEYTCQVRLRSGGYPAVSASARLQILEPP
LFFTPMRAETFGEFGGQVQLTCDVVGEPTPQVKWFRNAESVDAHIESGRYTLNTDNTLVI
KKLILDDAAMFQCLAINEAGENSASTWLRVKTSAPIMELPPQNVTALDGKDATISCRAVG
SPNPNITWIYNETQLVDISSRVQILESGDLLISNIRSVDAGLYICVRANEAGSVKGEAYL
SVLVRTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPYNIDWYREGQSSTPISNSQRIGVQ
ADGQLEIQAVRASDVGSYACVVTSPGGNETRAARLSVIELPFPPSNVKVERLPEPQQRSI
NVSWTPGFDGNSPISKFIIQRREVSELEKFVGPVPDPLLNWITELSNVSADQRWILLENL
KAATVYQFRVSAVNRVGEGSPSEPSNVVELPQEAPSGPPVGFVGSARSMSEIITQWQPPL
EEHRNGQILGYILRYRLFGYNNVPWSYQNITNEAQRNFLIQELITWKDYIVQIAAYNNMG
VGVYTEGSKIKTKEGVPEAPPTNVKVEAINSTAARCRWTPPNPQQINGINQGYKIQAWQR
RLIDGEWRDIERRMKTVPPSLIDPLAEQTAILGGLEKFTEYNISVLCFTDPGDGVASSQV
AVMTMDDVPDEVTGLHFDDVSDRSVKVLWAPPRASNGILTGYTVRYQVKDRPDTLKSFNL
TADDTELTVNQLQATTHYWFEIVAWTRVGSGIPKTATIQSGVEPVLPHAPTALALSNIEA
FSVVLQFTPGFDGNSSITKWKVEGQTARNMTWFTICEINDPDAETLTVTGLVPFTQYRLR
LSASNVVGSSKPSEATKDFQTIQARPKHPPFNVTVRAMSAQQLRVRWIPLQQTEWYGNPR
GYNISYKQLVKTPGTIKYVPRSVVIEDHTANSHVLDSLEEWTLYEVKMNACNDVGCSKES
DTAVERTREAVPSYGPLDVQANATSSTTVVVQWGEVPRQHRNGQIDGYKVFYAAADRGQQ
VLHKTIPNNATFTTTLTELKKYVVYHVQVLAYTRLGNGALSTPPIRVQTFEDTPGVPSNV
SFPDVSLTMARIIWDVPVDPNGKILAYQVTYTLNGSAMLNYSREFPPSDRTFRATELLPG
KYYSFSCTAQTRLGWGKIATALVYTTNNRERPQAPSVPQISRSQIQAHQITFSWTPGRDG
FAPLRYYTVEMRENEGRWQPLPERVDPSLSSFTAVGLRPYMTYQFRIQATNDLGPSAFSR
ESVIVRTLPAAPAVGVGGLKVVPITTTSVRVQWSALETALWNGDASTGGYRILYQQLSDF
PTALQSTPKTDVHGINENSVVLSDLQQDRNYEIVVLPFNSQGPGPATPPAAVYVGEAVPT
GEPRAVDAAPISSTEVRLLWKPPKQSMQNGDILGYKIYYLVTYSPQALEPGRKWEEEIEV
VSATATSHSLVFLDKFTEYRIQLLAFNPAGDGPRSAPITVKTLPGVPSAPLHLRFSDITM
QSLEVTWDPPKFLNGEILGYLVTYETTEENEKFSKQVKQKVSNTTLRVQNLEEEVTYTFT
VRAQTSVDYGPGISENVTTGPQDGSPVAPRDLILTKTLSSVEMHWINGPSGRGPILGYLI
EAKKRDDSRWTKIEQTRKGMMQDFTVSYHILMPSTAYTFRVIAYNRYGISFPVYSKDSIL
TPSKLHLEYGYLQHKPFYRQTWFMVSLAATSIVIIVMVIAVLCVKSKSYKYKQEAQKTLE
ESMAMSIDERQELALELYRSRHGVGTGTLNSVGTLRSGTLGTLGRKSTSRPPPGVHLGKS
PPRPSPASVAYHSDEESLKCYDENPDDSSVTEKPSEVSSSEASQHSESENESVRSDPHSF
VNHYANVNDSLRQSWKKTKPVRNYSSYTDSEPEGSAVMSLNGGQIIVNNMARSRAPLPGF
SSFV
Download sequence
Identical sequences E1JJC3 O97394
NP_001162630.1.81976 NP_001162631.1.81976 NP_477289.5.81976 NP_599141.5.81976 NP_599142.5.81976 FBpp0070125 FBpp0070127 FBpp0070128 FBpp0291468 FBpp0291469 FBpp0070125 FBpp0070127 FBpp0070128 FBpp0291468 FBpp0291469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]