SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070170 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070170
Domain Number 1 Region: 87-397
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.95e-71
Family gamma-Butyrobetaine hydroxylase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070170   Gene: FBgn0014903   Transcript: FBtr0070175
Sequence length 406
Comment pep:known chromosome:BDGP5:X:925538:927198:1 gene:FBgn0014903 transcript:FBtr0070175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSCRQLISRLSLLRQASTFACVRLCPDYVEVQEEQGNLLKYPQVWLRDNCQCAECFHAA
TRARKSHWDRGPLNIPVSQVAYNKERKQLEIIWQDKHRSTFDLGWLRERDFGETGRKHYL
EEVYKPPAQLWGKTEFEDVKREFQYEDVLEQDAALRVWLEALAVQGFAILKGAPNDINVA
KKLAERIGYIKRTTYGDVFEVKSKPNARNYAYLMTPLPLHTDMPYYEYKAGINILHTLVQ
SESKGGANTLTDGFNVASQLQKLHPEDFEVLKSVPVNWFDIGHDGDDSKPFHSLWRAPVI
CLDVDGRFARINQNTTKRDSRFSVSLAQAVSWYKAYDKFLEIAQSEAVEFKTQAGDVFVF
NNLRMLHGRTAYEDAPGNKRHLVGAYVDWDIIYSKLRTLKFPNAKD
Download sequence
Identical sequences Q9W5B5
FBpp0070170 FBpp0070170 FBpp0070170 NP_651985.1.81976 7227.FBpp0070170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]