SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070221 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0070221
Domain Number - Region: 189-254
Classification Level Classification E-value
Superfamily Ferritin-like 0.00405
Family Ribonucleotide reductase-like 0.017
Further Details:      
 
Domain Number - Region: 707-808,855-904
Classification Level Classification E-value
Superfamily TPR-like 0.0683
Family BTAD-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070221   Gene: FBgn0027794   Transcript: FBtr0070230
Sequence length 1072
Comment pep:known chromosome:BDGP5:X:1351208:1354650:-1 gene:FBgn0027794 transcript:FBtr0070230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRARLLRNVWLCRQRLGHLPGRSASSASLAFRYATKPAAPAVPFSLLQMRSLGTGGVLS
AVERRSRRPASSSEKPKASVADAWTQLEAYYRQHDLINFEHCQRLLELLQESASPLGVGI
EEVHFLLGSCVPELLPAQSSQERLQLFKGLWAQLIKLGQPTLAHYHTKLQVLRQNRLPLT
DYRSLLAEIAVYHGAADSTLYGALLDVAGAAGNMRMATEILSEMRERSLALTEHNFHALL
LGHARSGDLPGAESVLASMRAAGIQQGSSTQAIWFEALLENGQLAQAKELLQVEHGFTAP
QLLQMLRGLLASKDVDTDLIQLLVKELPREFLTGIDLPPAIRSLCIQLVHQGRTEVVIQL
VGALPAPKFELQNQNVDEYGALLLQEFFRAQVPLDQTIQFAGQLVQRNQNVRALHLVAEL
ALRRQPSSALRCLEDLSAAGEELRPHYFWPLILHHYRREGESGMLRLVSEMRRLRVECDE
ETLRHYLFPHLRQTLVQPLEAVKALESAGVKPSQTLCPVVSHLLQQHQMSEVLDLLDRYP
TRLDLATLLQPLSSLAVNARATKRFEVFAKVIQALQQKALKRGEDFVGSLLLQMTGPQTR
LRQDATSLRRFLHELRRLELQISPAASEALLSVVRHATDDVDLIQDLAKTLQKMKNPQLA
LPADTVSLHGGFIKHPRDMSIDELECHLVELESKQLNPRGVLRRLLQLSVRSGRLERAQQ
LLAKCQVLKVQESAGMMASIFDLHIKLRDLPRAQESLERLSSMYPAFQIDEHKVIDYAAL
LVQGQQLEAAKQLLQRRAEQHKVVGGDYVMKNVWQLLTNVGQLAASSHAGGESSKQLNQT
REWLDFLRGLGYCQSQNALLGPVVREWLLKGNLDAAVAEFQRLANTHKHTPLQFELLSLL
VRLGNGDEQELTRFPGVTAESAQQHLAVVTATVSRIHGAANMNSALLLALAESGKETQLR
RLIINPEFRINHELLVKNCEHLGQEGAVRTLLRLARGVRGVQRTIDEQKIYDLLLAQFCR
SNDYEAALDLFERLEADDELKVSHEFLRNLVQLLQVNQVEIPSTIALRAHVR
Download sequence
Identical sequences Q9W592
FBpp0070221 FBpp0070221 NP_569913.1.81976 7227.FBpp0070221 FBpp0070221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]