SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070259 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070259
Domain Number 1 Region: 870-915
Classification Level Classification E-value
Superfamily RING/U-box 0.00000958
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Weak hits

Sequence:  FBpp0070259
Domain Number - Region: 577-739
Classification Level Classification E-value
Superfamily ARM repeat 0.00109
Family Clathrin heavy chain proximal leg segment 0.013
Further Details:      
 
Domain Number - Region: 100-251
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0641
Family WD40-repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070259   Gene: FBgn0000482   Transcript: FBtr0070269
Sequence length 1002
Comment pep:known chromosome:BDGP5:X:1559088:1562484:1 gene:FBgn0000482 transcript:FBtr0070269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSMPNQPKFLPRIEHNSSGATANSYVATASGNPFETDDEDEIFSRHKMVLRVPSNCTG
DLMHLAVSRNWLVCLLGTPERTTLLRFFLPRAIPPGEAVLEKYLSGSGYKITRMFLDPTG
HHIIIALVPKSATAGVSPDFLYIHCLESPQAQQLKVRRIEKFKDHEITAVAFNPYHGNES
STGPILLGTSRGLIFETELNPAADGHVQRKQLYDLGLGRPKYPITGLKLLRVPNSSRYII
VVTSPECIYTFQETLKAEERSLQAIFAGYVSGVQEPHCEERKTDLTFSQLRFFAPPNSKY
PKQWAWLCGEGIRVGELSIEANSAATLIGNTLINLDFEKTMHLSYGERRLNTPKAFVLTE
YHAVLLYADHVRAICLLNQEQVYQEAFDEARVGKPLSIERDELTGSIYVYTVKTVFNLRV
TREERNVWRIYLDKGQYELATAHAAEDPEHLQLVLCQRADAAFADGSYQVAADYYAETDK
SFEEVCLKFMVLPDKRPIINYVKKRLSRVTTKPMETDELDEDKMNIIKALVIWLIDLYLI
QINMPDKDEEWRSSWQTEYDEFMMEAHVLSCTRQNRETVRQLIAEHADPRNMAQFAIAIG
DYDEVVAQQLKAECYAEALQTLINQRNPELFYKYAPELITRLPKPTVDALMAQGSRLEVE
KLVPTLIIMENREQREQTQRYLEFAIYKLNTTNDAIHNFLLHLYAEHEPKLLMKYLEIQG
RDESLVHYDIYYAHKVCTDLDVKEARVFLECMLRKWISAVDLALTFDMKLAKETASRPSD
SKIRRKLWLRIAYHDIKGTNDVKKALNLLKECDLLRIEDLLPFFADFEKIDNFKEAICDA
LRDYNQRIQELQREMAETTEQTDRVTAELQQLRQHSLTVESQDTCEICEMMLLVKPFFIF
ICGHKFHSDCLEKHVVPLLTKEQCRRLGTLKQQLEAEVQTQAQPQSGALSKQQAMELQRK
RAALKTEIEDILAADCLFCGLLISTIDQPFVDDWEQVNVEWE
Download sequence
Identical sequences FBpp0070259 FBpp0070259 NP_477286.2.81976 FBpp0070259 7227.FBpp0070259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]