SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070352 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070352
Domain Number 1 Region: 235-558
Classification Level Classification E-value
Superfamily TPR-like 1.64e-101
Family Tetratricopeptide repeat (TPR) 0.000000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070352   Gene: FBgn0023516   Transcript: FBtr0070368
Sequence length 559
Comment pep:known chromosome:BDGP5:X:1760865:1762836:-1 gene:FBgn0023516 transcript:FBtr0070368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRPLVEGDCGGVNPLMQLGGQFTRDVAHKDEGYVQRHFERAARPEDQLINEFLGQVTA
PPQSFQMDTLLQEMRDINIHGNPQQQMHSQQAEQWGQDFARGLAPALPNKMIHMQAQQQD
LQHAQEFFDEPLISSQNFRSLPPLRQPLMPIAAGQQQDPFFDSAMETIITDHLPQAPQGE
SLDDWISDYQRSTEQKEQTAANFNEKFWERLQDEWQKLADENEHPWLSEYNDNMDAYKEY
EFAEGNPMSDVENPFEKGKEYLSKGDIPSAVLCFEVAAKKQPERAEVWQLLGTSQTENEM
DPQAIAALKRAYDLQPDNQQVLMALAACYTNEGLQNNAVRMLCNWLTVHPKYQHLVAAHP
ELQAEGTSLASSLIGPSKLRDLQQIYLEAVRQHPSEVDAEVQDALGVLYNLSGEFDKAVD
CYQSALQVDPQNAKTWNRLGASLANGSRSVEAVEAYQQALQLQPGFIRVRYNVGVCCMNL
KAYKEAVEHLLTALTMQAHTNAARELPNAAMAATFRGQNQMSESIWSTLKMVISLMGRSD
LQSYVSDRNLAALNEAFKD
Download sequence
Identical sequences Q7KW08
FBpp0070352 NP_569949.3.81976 FBpp0070352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]