SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070416 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070416
Domain Number 1 Region: 1503-1577
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.71e-17
Family SAM (sterile alpha motif) domain 0.0000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070416   Gene: FBgn0004861   Transcript: FBtr0070432
Sequence length 1589
Comment pep:known chromosome:BDGP5:X:2020243:2030578:-1 gene:FBgn0004861 transcript:FBtr0070432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRRALKFMQKRADTESDTTTPVSTTASQGISASAILAGGTLPLKDNSNIREKPLHHNYN
HNNNNSSQHSHSHQQQQQQQVGGKQLERPLKCLETLAQKAGITFDEKYDVASPPHPGIAQ
QQATSGTGPATGSGSVTPTSHRHGTPPTGRRQTHTPSTPNRPSAPSTPNTNCNSIARHTS
LTLEKAQNPGQQVAATTTVPLQISPEQLQQFYASNPYAIQVKQEFPTHTTSGSGTELKHA
TNIMEVQQQLQLQQQLSEANGGGAASAGAGGAASPANSQQSQQQQHSTAISTMSPMQLAA
ATGGVGGDWTQGRTVQLMQPSTSFLYPQMIVSGNLLHPGGLGQQPIQVITAGKPFQGNGP
QMLTTTTQNAKQMIGGQAGFAGGNYATCIPTNHNQSPQTVLFSPMNVISPQQQQNLLQSM
AAAAQQQQLTQQQQQFNQQQQQQLTQQQQQLTAALAKVGVDAQGKLAQKVVQKVTTTSSA
VQAATGPGSTGSTQTQQVQQVQQQQQQTTQTTQQCVQVSQSTLPVGVGGQSVQTAQLLNA
GQAQQMQIPWFLQNAAGLQPFGPNQIILRNQPDGTQGMFIQQQPATQTLQTQQNQIIQCN
VTQTPTKARTQLDALAPKQQQQQQQVGTTNQTQQQQLAVATAQLQQQQQQLTAAALQRPG
APVMPHNGTQVRPASSVSTQTAQNQSLLKAKMRNKQQPVRPALATLKTEIGQVAGQNKVV
GHLTTVQQQQQATNLQQVVNAAGNKMVVMSTTGTPITLQNGQTLHAATAAGVDKQQQQLQ
LFQKQQILQQQQMLQQQIAAIQMQQQQAAVQAQQQQQQQVSQQQQVNAQQQQAVAQQQQA
VAQAQQQQREQQQQVAQAQAQHQQALANATQQILQVAPNQFITSHQQQQQQQLHNQLIQQ
QLQQQAQAQVQAQVQAQAQQQQQQREQQQNIIQQIVVQQSGATSQQTSQQQQHHQSGQLQ
LSSVPFSVSSSTTPAGIATSSALQAALSASGAIFQTAKPGTCSSSSPTSSVVTITNQSST
PLVTSSTVASIQQAQTQSAQVHQHQQLISATIAGGTQQQPQGPPSLTPTTNPILAMTSMM
NATVGHLSTAPPVTVSVTSTAVTSSPGQLVLLSTASSGGGGSIPATPTKETPSKGPTATL
VPIGSPKTPVSGKDTCTTPKSSTPATVSASVEASSSTGEALSNGDASDRSSTPSKGATTP
TSKQSNAAVQPPSSTTPNSVSGKEEPKLATCGSLTSATSTSTTTTITNGIGVARTTASTA
VSTASTTTTSSGTFITSCTSTTTTTTSSISNGSKDLPKAMIKPNVLTHVIDGFIIQEANE
PFPVTRQRYADKDVSDEPPKKKATMQEDIKLSGIASAPGSDMVACEQCGKMEHKAKLKRK
RYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEAMAEEKMQTEATPKL
SESFPILGASTEVPPMSLPVQAAISAPSPLAMPLGSPLSVALPTLAPLSVVTSGAAPKSS
EVNGTDRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMK
LGPALKIVAKVESIKEVPPPGEAKDPGAQ
Download sequence
Identical sequences P39769
7227.FBpp0070416 NP_476871.2.81976 FBpp0070416 FBpp0070416 FBpp0070416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]