SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070417 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070417
Domain Number 1 Region: 1461-1527
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.57e-17
Family SAM (sterile alpha motif) domain 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070417   Gene: FBgn0004860   Transcript: FBtr0070433
Sequence length 1537
Comment pep:known chromosome:BDGP5:X:2010899:2015757:-1 gene:FBgn0004860 transcript:FBtr0070433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHGFGAAPSVSVSGDTESESATTIRTPPPSPEATTSVKVNSTTRVDPQRPLRCLETLAQ
KAGISFDEDFAKSPSQSPSSKAARGSVGTPSIRRRHPLLPLSSRSPSAPDSKTTGRKLEK
SQSPAQQVAAATNVPLQISPEQLQQLYANNPYAIQVKQEFPTHTTSGSGTELKHATNIME
VQQQLQLQQQLSEANGGGAASAGAGGAASPANSQQSQQQQHSTAISTMSPMQLAAATGGV
GGDWTQGRTVQLMQPSTSFLYPQMIVSGNLLHPGGLGQQPIQVITAGKPFQGNGPQMLTT
TTQNAKQMIGGQAGFAGGNYATCIPSNHNQSPQTVLISPVNVISHSPQQQQNLLQSMAAA
AQQQQLTQQQQQQLNQQQQQLNQQQQQQQLTAALAKVGVDAQGKLAQKVVQKVTTTSSTV
QAATGPGSTGSTQTQQVQQVQQQQQQTTQTTQQCVQVSQSTLPVGVGGQSVQTAQLLNAG
QAQQMQIPWFWQNAAGLQPFGSNQIILRNQPDGTQGMFIQQQPATQTLQTQQNQIIQCNV
TQTPTKARTQLDALAPKQQQQQQQVGTTNQTQQQQLAVATAQLQQQQQQLTAAALQRPGA
PVMPHNGTQVRPASSVSTQTAQNQSLLKAKMRNKQQPVRPALATLKTEIGQVAGQNKVVG
HLTTVQQQQQATNLQQVVNAAGNKMVVMSTTGTPITLQNGQTLHAATAAGVDKQQQQLQL
FQKQHILQQQMLQQQIAAIQMQQQQAAVQAQQQQQQQVSQQQQVNAQQQQAVAQQQQAVA
QAQQQQREQQQQVAQAQAQHQQALANATQQILQVAPNQFITSHQQQQQQQLHNQLIQQQL
QQQAQAQVQAQVQAQAQQQQQQREQQQNIIQQIVVQQSTGATSQQQQQQPQQQSGQLQLS
SVPFSVSPSMTAEDIAGITSSALQEALSVSGAIFQTTKPITCSSSTLPTSSVVTITSQSS
TPLVTSSTVASMQQAQTQGTQIHQHQQLISATIAGGSQQQQQQQQLGLPSLTPTTPSPTT
NPILAMTSMMNATVGHLSTAPPVSVSSTAVTPSSGQLVTLSSASSGGGAGFPATPTKETP
SKGPTATLVPIDSPKTPVSGKDTCTTPKSSTPATVSASVEASSSTGEALSNGDASDRSST
PSKGATTPTSKQSNAAVQPPSSTIPNSVSGKEEPKLTTCGSLTSATSTSTTTTITNGIGV
ARTTASTAVSTASTTTTSSGTFTTSCTSTTTTTTSSISNGSKDLPKAMIKPNVLTHVIDG
FIIQEANEPFPVTRQRYADKDVSDEPPKKKATMQEDIKLSGIASAPGSDMVACEQCGKME
HKAKLKRKRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEAMAEEKM
QTESYQTVSDALPIQAATPEVPPISMPVLAAMSTSSPLSLPLTLPLPIAIAPTVSLPVVS
AGVVAPVLAIPSSNINGSDRPPISSWSVEEVSNFIRELPGCQDYVDDFIQQEIDGQALLL
LKENHLVNAMGMKLGPALKIVAKVESIKEVPPGDVKD
Download sequence
Identical sequences Q9W523
FBpp0070417 7227.FBpp0070417 NP_524794.2.81976 FBpp0070417 FBpp0111756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]