SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070456 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070456
Domain Number 1 Region: 367-425
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000471
Family SAM (sterile alpha motif) domain 0.0045
Further Details:      
 
Domain Number 2 Region: 180-239
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000135
Family PHD domain 0.013
Further Details:      
 
Domain Number 3 Region: 127-190
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000908
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070456   Gene: FBgn0024993   Transcript: FBtr0070478
Sequence length 446
Comment pep:known chromosome:BDGP5:X:2592737:2594951:1 gene:FBgn0024993 transcript:FBtr0070478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQSKDEDKEESPVQPTTHNSSAGSNGHDAKSPVVTTAPAATCSVSVSDASGAGASVRTT
GRVKKPKQVYDPSDNYVSRASSNRNSLSSVPATSNVQSPPVKEATDSQDSTTSPVSEQQQ
QQLQQAAQLRNFDTCQKCGKSEPKRGSGHKSNFLTCKGCMQKWHFPCLPITFHNQSTARK
KFKCDKCRYCRLCNVRGPGLSICSLCVDAYHPDCNDPTLKQSKAVEANPNWRCFRCEACN
IGGSTSASSEEQTGARKSTASREDQAQPVVPRKSNAGRKKRVQSEPTGQEKAAKIEKLAK
RRQPLKTEKKKEYKKEEDEEPAQIKVKVEKVEPVDMETEQIENNDLPGPEQESLSLRLTP
ITAVERRSHPVSTWSVEQVVQFVAKRYPKEANVFRYQDIDGASLLLLNRHDVMNGFGLKL
GPALRVFELVMSLQTQSNDVGLAWLD
Download sequence
Identical sequences Q9W4W7
FBpp0070456 FBpp0070456 NP_001284832.1.81976 NP_570018.1.81976 FBpp0070456 7227.FBpp0070456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]