SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070458 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070458
Domain Number 1 Region: 259-443
Classification Level Classification E-value
Superfamily TRAF domain-like 1.05e-28
Family SIAH, seven in absentia homolog 0.0019
Further Details:      
 
Domain Number 2 Region: 198-249
Classification Level Classification E-value
Superfamily RING/U-box 0.00000244
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070458   Gene: FBgn0024997   Transcript: FBtr0070480
Sequence length 626
Comment pep:known chromosome:BDGP5:X:2602717:2605701:1 gene:FBgn0024997 transcript:FBtr0070480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLANGGKEEDLKILAQLKSIEQINEQRRIFLNSTINEEVPEATNGSTVREEDLEKNLK
AIDEPQSTKMPPEEVAKKTPDEVPAQEQQKEPEKVEPAKPVPPNTLTLNVKYATLPSPNV
VTLRSPLSPPPKPPMLGRTRSTGPADGKGPASNGALSPDSSIIRQSFPEGVITPSKPEKS
PATPSEEGPPTVSARHYEGLIEELRCPGCAGAMKAPILLCKSGHSVCEQCTRILLMCPLC
KEPFTNSRSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHEQQCMYKPMKCFMGRVWG
DCRWQGREVQWKEHLEEQHDDRLFRSSSADLEWNLGTRRKPLTGYYVFQAHDEMFNFYEI
HDRQRVLFTMTCTSNRRDSKYNFAYEVTVLLPDNEALSMTQKFPVHSEYDKDILMEGTCV
SIPLTELNRFLDQDKVLHYRVSVLAVKSPRRAKPPRQNLPQPADLEQAPNGGVNVKSVPT
NMIITRTYKEAIGEVTKADVASPDSEEDPAAADGAGAIGADGAGGVELERKWGTPQLHFN
RKYLRNTLNDATPAEDELRPLAADLRNGNGDDKLSQCSNSTSYTKKVSDSLRRSFRALKA
DIVELRPFSKKAVRDGSTSPVQSNGK
Download sequence
Identical sequences Q9W4W4
FBpp0070458 7227.FBpp0070458 FBpp0070458 FBpp0070458 NP_570022.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]