SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070464 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070464
Domain Number 1 Region: 19-76
Classification Level Classification E-value
Superfamily RING/U-box 0.0000459
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Weak hits

Sequence:  FBpp0070464
Domain Number - Region: 93-127
Classification Level Classification E-value
Superfamily CorA soluble domain-like 0.0379
Family CorA soluble domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070464   Gene: FBgn0024977   Transcript: FBtr0070486
Sequence length 237
Comment pep:known chromosome:BDGP5:X:2620740:2621522:1 gene:FBgn0024977 transcript:FBtr0070486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSQAGQTVEPEASKLWIHCNSCCALFCDKKHTFFLLACHHVFCERCVKVSAGRTPSDA
PIFECSTCRRSVRGRQLTNSMPNHFKQLFHPEPFTIGNDFVETFQRGNHRHFDKYKERKE
LEMDKLFKDIEVAKSVCQKRFLEAQMLRVERKKLMQRSRYIKAEVANRKAEMHRMAQAYR
SRSLTSQSSSSAQRSARGRPRGRGTATQSSSRRRSTESAKRQQITSFIHPPNNSFDL
Download sequence
Identical sequences O76908
FBpp0070464 7227.FBpp0070464 FBpp0070464 NP_570026.1.81976 FBpp0070464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]